2. Signaling Pathways
  3. Metabolic Enzyme/Protease
  4. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Related Products

PDF 1.4 MB

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-116023
    Moveltipril
    		Inhibitor 99.89%
    Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor.
    Moveltipril
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-163438
    BKIDC-1553
    		Inhibitor 99.65%
    BKIDC-1553 is an orally active antiglycolytic agent and a bumped kinase inhibitor derived compound with a predicted ~17 h half-life in human. BKIDC-1553 inhibits CYP2C8 and Angiotensin Converting Enzyme and can be used for cancer research.
    BKIDC-1553
  • HY-RS00152
    ACE2 Human Pre-designed siRNA Set A
    		Inhibitor

    ACE2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
    ACE2 Human Pre-designed siRNA Set A
    ACE2 Human Pre-designed siRNA Set A
  • HY-P0095
    Acetyl tetrapeptide-5
    		Inhibitor 98.05%
    Acetyl tetrapeptide-5 inhibits glycosylation and ACE-1 activity. Acetyl tetrapeptide-5 reduces edema and relieves vascular pressure by improving the vascular system and strengthening the skin under the eyes. Acetyl tetrapeptide-5 can be used in the research of Antioxidant, anti-aging skin care.
    Acetyl tetrapeptide-5
  • HY-109592
    Imidaprilate
    		Inhibitor
    Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.
    Imidaprilate
  • HY-P0318
    Hemorphin-7
    		Inhibitor
    Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
    Hemorphin-7
  • HY-A0116A
    Trandolaprilate hydrate
    		Inhibitor
    Trandolaprilate hydrate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity.
    Trandolaprilate hydrate
  • HY-N7450
    Icariside D2
    		Inhibitor ≥98.0%
    Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
    Icariside D2
  • HY-P3141
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
  • HY-A0043A
    Cilazapril monohydrate
    		Inhibitor 99.94%
    Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
    Cilazapril monohydrate
  • HY-P0266A
    N-Acetyl-Ser-Asp-Lys-Pro TFA
    N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of ACE.
    N-Acetyl-Ser-Asp-Lys-Pro TFA
  • HY-127026
    Quinaprilat
    		Inhibitor
    Quinaprilat is an orally active non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat acts as anti-hypertensive agent and vasodilator.
    Quinaprilat
  • HY-18206S
    Lisinopril-d5
    		Inhibitor
    Lisinopril-d5 is the deuterium labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.
    Lisinopril-d<sub>5</sub>
  • HY-B0231BS
    Enalaprilat-d5 sodium
    		Inhibitor ≥98.0%
    Enalaprilat-d5 (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
    Enalaprilat-d<sub>5</sub> sodium
  • HY-B0592R
    Trandolapril (Standard)
    		Inhibitor
    Trandolapril (Standard) is the analytical standard of Trandolapril. This product is intended for research and analytical applications. Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI).
    Trandolapril (Standard)
  • HY-B0368R
    Captopril (Standard)
    		Inhibitor
    Captopril (Standard) is the analytical standard of Captopril. This product is intended for research and analytical applications. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM.
    Captopril (Standard)
  • HY-B0279S
    Ramipril-d5
    		Inhibitor ≥99.0%
    Ramipril-d5 is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.
    Ramipril-d<sub>5</sub>
  • HY-U00074
    Rentiapril racemate
    		Inhibitor 98.96%
    Rentiapril racemate (SA-446 racemate) is the racemate of Rentiapril. Rentiapril is an angiotensin converting enzyme (ACE) inhibitor.
    Rentiapril racemate
  • HY-A0043
    Cilazapril
    		Inhibitor
    Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
    Cilazapril
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity