1. Signaling Pathways
  2. Metabolic Enzyme/Protease
  3. Angiotensin-converting Enzyme (ACE)

Angiotensin-converting Enzyme (ACE)

Angiotensin-converting enzyme (ACE) indirectly increases blood pressure by causing blood vessels to constrict. ACE does that by converting angiotensin I to angiotensin II, which constricts the vessels. ACE, angiotensin I and angiotensin II are part of the renin-angiotensin system (RAS), which controls blood pressure by regulating the volume of fluids in the body. ACE is secreted in the lungs and kidneys by cells in the endothelium (inner layer) of blood vessels. It has two primary functions: ACE catalyses the conversion of angiotensin I to angiotensin II, a potent vasoconstrictor in a substrate concentration-dependent manner. ACE degrades bradykinin, a potent vasodilator, and other vasoactive peptides. These two actions make ACE inhibition a goal in the treatment of conditions such as high blood pressure, heart failure, diabetic nephropathy, and type 2 diabetes mellitus. Inhibition of ACE (by ACE inhibitors) results in the decreased formation of angiotensin II and decreased metabolism of bradykinin, leading to systematic dilation of the arteries and veins and a decrease in arterial blood pressure.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-P10173
    Abz-LFK(Dnp)-OH
    98.52%
    Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity.
    Abz-LFK(Dnp)-OH
  • HY-126404
    Casein hydrolysate
    Inhibitor
    Casein hydrolysate is the hydrolysis product of Casein (HY-125865). Casein hydrolysate reduces the blood pressure, through inhibition of angiotensin-converting enzyme (ACE) and reduction of bradykinin breakdown.
    Casein hydrolysate
  • HY-B0279S
    Ramipril-d5
    Inhibitor ≥99.0%
    Ramipril-d5 is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.
    Ramipril-d<sub>5</sub>
  • HY-N9528
    Lyciumin A
    Inhibitor ≥99.0%
    Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension.
    Lyciumin A
  • HY-108321
    Zofenopril
    Inhibitor 98.81%
    Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
    Zofenopril
  • HY-116023
    Moveltipril
    Inhibitor 99.89%
    Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor.
    Moveltipril
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-163438
    BKIDC-1553
    Inhibitor 99.65%
    BKIDC-1553 is an orally active antiglycolytic agent and a bumped kinase inhibitor derived compound with a predicted ~17 h half-life in human. BKIDC-1553 inhibits CYP2C8 and Angiotensin Converting Enzyme and can be used for cancer research.
    BKIDC-1553
  • HY-RS00152
    ACE2 Human Pre-designed siRNA Set A
    Inhibitor

    ACE2 Human Pre-designed siRNA Set A contains three designed siRNAs for ACE2 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    ACE2 Human Pre-designed siRNA Set A
    ACE2 Human Pre-designed siRNA Set A
  • HY-109592
    Imidaprilate
    Inhibitor
    Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.
    Imidaprilate
  • HY-P0318
    Hemorphin-7
    Inhibitor
    Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
    Hemorphin-7
  • HY-108321S
    Zofenopril-d5
    Inhibitor 99.92%
    Zofenopril-d5 is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
    Zofenopril-d<sub>5</sub>
  • HY-N7450
    Icariside D2
    Inhibitor ≥98.0%
    Icariside D2, isolated from Annona glabra fruit, inhibits angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC50 value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .
    Icariside D2
  • HY-P3141
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
    STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
  • HY-A0043A
    Cilazapril monohydrate
    Inhibitor 99.94%
    Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.
    Cilazapril monohydrate
  • HY-P0266A
    N-Acetyl-Ser-Asp-Lys-Pro TFA
    N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of ACE.
    N-Acetyl-Ser-Asp-Lys-Pro TFA
  • HY-B0231BS
    Enalaprilat-d5 sodium
    Inhibitor ≥98.0%
    Enalaprilat-d5 (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
    Enalaprilat-d<sub>5</sub> sodium
  • HY-B0592R
    Trandolapril (Standard)
    Inhibitor
    Trandolapril (Standard) is the analytical standard of Trandolapril. This product is intended for research and analytical applications. Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI).
    Trandolapril (Standard)
  • HY-B0331AS
    Enalapril-d5 maleate
    Inhibitor ≥98.0%
    Enalapril-d5 (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.
    Enalapril-d<sub>5</sub> maleate
  • HY-B0368R
    Captopril (Standard)
    Inhibitor
    Captopril (Standard) is the analytical standard of Captopril. This product is intended for research and analytical applications. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM.
    Captopril (Standard)
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity